Invitrogen™ Human TPPP2 (aa 8-150) Control Fragment Recombinant Protein

Product Code. 30196120

Brand: Invitrogen™ RP88943

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52055 (PA5-52055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: P59282
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 122664
• Name: Human TPPP2 (aa 8-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C14orf8; CT152; Gm1790; Gm77; P18; p25 beta; p25beta; Protein p25-beta; RGD1566185; TPPP/p18; TPPP2; tubulin polymerization promoting protein family member 2; tubulin polymerization-promoting protein family member 2
• Common Name: TPPP2
• Gene Symbol: TPPP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining