Invitrogen™ Human TPP2 (aa 1029-1175) Control Fragment Recombinant Protein

Product Code. 30212525

Brand: Invitrogen™ RP104877

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65570 (PA5-65570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.

Spezifikation

• Accession Number: P29144
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7174
• Name: Human TPP2 (aa 1029-1175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: TPP2; TPP-2; TppII; TPP-II; Tripeptidyl aminopeptidase; tripeptidyl peptidase 2; tripeptidyl peptidase II; tripeptidyl-peptidase 2; Tripeptidyl-peptidase II
• Common Name: TPP2
• Gene Symbol: TPP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQAQDGAISTDAEGKEEEGESPLDSLAETFWETTKWTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining