Invitrogen™ Human TPH1 (aa 338-444) Control Fragment Recombinant Protein

Product Code. 30200905

Brand: Invitrogen™ RP88606

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tryptophan hydroxylase (TPH) catalyzes the 5-hydroxylation of tryptophan, which is the first step in the biosynthesis of indoleamines (serotonin and melatonin) (Martinez et al., 2001). In mammals, serotonin biosynthesis occurs predominantly in neurons which originate in the Raphe nuclei of the brain, and melatonin synthesis takes place within the pineal gland. Although TPH catalyzes the same reaction within the Raphe nuclei and the pineal gland, TPH activity is rate-limiting for serotonin but not melatonin biosynthesis. Serotonin functions mainly as a neurotransmitter, whereas melatonin is the principal hormone secreted by the pineal gland. The activity of TPH is enhanced by phosphorylation by cAMP-dependent protein kinase (PKA) and Ca2+/calmodulin kinase II (CAM K II) (Jiang et al., 2000; Johansen et al., 1996). Both PKA and CAM K II phosphorylate Ser58 which lies within the regulatory domain of TPH (Kuhn et al., 1997).

Specifications

• Accession Number: P17752
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7166
• Name: Human TPH1 (aa 338-444) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: indoleacetic acid-5-hydroxylase; L-tryptophan hydroxylase; MGC119994; TPH; Tph1; TPH2; TPRH; TRPH; tryptophan 5-hydroxylase 1; Tryptophan 5-monooxygenase 1; tryptophan hydroxylase; tryptophan hydroxylase (tryptophan 5-monooxygenase); tryptophan hydroxylase 1; tryptophan hydroxylase 1 (tryptophan 5-monooxygenase)
• Common Name: TPH1
• Gene Symbol: TPH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining