Invitrogen™ Human TPCN2 Control Fragment Recombinant Protein

Product Code. 30197572

Brand: Invitrogen™ RP91224

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55498 (PA5-55498. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tpcn2 is a nicotinic acid adenine dinucleotide phosphate (NAADP) receptor that may function as one of the major voltage-gated Ca(2+) channels (VDCC) across the lysosomal membrane. Tpcn2 may also be involved in smooth muscle contraction. The Tpcn2 gene encodes a putative cation-selective ion channel with two repeats of a six-transmembrane-domain. The Tpcn2 protein localizes to lysosomal membranes and enables nicotinic acid adenine dinucleotide phosphate (NAADP) -induced calcium ion release from lysosome-related stores. Tpcn2 is a ubiquitously expressed gene that has elevated expression in liver and kidney. Two common nonsynonymous SNPs in the Tpcn2 gene strongly associate with blond versus brown hair pigmentation. Diseases associated with TPCN2 include Deafness, Autosomal Recessive 63 and Deafness, Autosomal Recessive 7.

Specifications

• Accession Number: Q8NHX9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 219931
• Name: Human TPCN2 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC025890; D830047E22Rik; SHEP10; Tpc2; TPCN2; Two pore calcium channel protein 2; two pore segment channel 2; two-pore calcium channel protein 2; voltage-dependent calcium channel protein TPC2
• Common Name: TPCN2
• Gene Symbol: TPCN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining