Invitrogen™ Human TPCN1 (aa 331-426) Control Fragment Recombinant Protein

Product Code. 30182438

Brand: Invitrogen™ RP97881

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58915 (PA5-58915. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane. Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000).

Specifications

• Accession Number: Q9ULQ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 53373
• Name: Human TPCN1 (aa 331-426) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730403B01Rik; FLJ20612; Kiaa1169; mKIAA1169; si:dkey-125i10.5; TPC1; TPCN1; Two pore calcium channel protein 1; two pore channel 1; two pore segment channel 1; two-pore channel 1; two-pore channel 1, homolog; two-pore segment channel 1; voltage-dependent calcium channel protein TPC1; voltage-gated Ca channel
• Common Name: TPCN1
• Gene Symbol: TPCN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKSLLLHKRTAIQHAYRLLISQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWFDELPRT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining