Invitrogen™ Human TOX2 (aa 35-85) Control Fragment Recombinant Protein

Product Code. 30180486

Brand: Invitrogen™ RP99344

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TOX2 (TOX High Mobility Group Box Family Member 2) is a Protein Coding gene. Diseases associated with TOX2 include Conduct Disorder. Gene Ontology (GO) annotations related to this gene include chromatin binding and RNA polymerase II transcription factor binding. An important paralog of this gene is TOX.

Specifications

• Accession Number: Q96NM4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84969
• Name: Human TOX2 (aa 35-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI851523; AV026525; BI987407; C20orf100; dJ1108D11.2; dJ495O3.1; GCX1; Gcx-1; granulosa cell HMG box 1; granulosa cell HMG box protein 1; granulosa cell HMG-box protein 1; granulosa cell HMG-box protein-1; LOW QUALITY PROTEIN: TOX high mobility group box family member 2; RxHMG1; TOX high mobility group box family member 2; TOX2
• Common Name: TOX2
• Gene Symbol: TOX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining