Invitrogen™ Human Torsin 1A (aa 19-77) Control Fragment Recombinant Protein

Product Code. 30197126

Brand: Invitrogen™ RP106327

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65651 (PA5-65651. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1.

Specifications

• Accession Number: O14656
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1861
• Name: Human Torsin 1 A (aa 19-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DQ2; dystonia 1; Dystonia 1 protein; Dystonia 1 torsion; dystonia 1, torsion (autosomal dominant; dystonia 1, torsion (autosomal dominant; torsin A); DYT1; LOW QUALITY PROTEIN: torsin-1 A; TA; Tor1a; TORA; Torsin 1 A; torsin A; torsin ATPase 1; Torsin ATPase-1 A; torsin family 1 member A; torsin family 1, member A; torsin family 1, member A (torsin A); torsin-1 A; torsinA
• Common Name: Torsin 1 A
• Gene Symbol: Tor1a
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining