missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Torc1 (aa 264-322) Control Fragment Recombinant Protein

Product Code. 30208042
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208042

Brand: Invitrogen™ RP109044

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. In the hippocampus, involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. May be required for dendritic growth of developing cortical neurons. In concert with SIK1, regulates the light-induced entrainment of the circadian clock. In response to light stimulus, coactivates the CREB-mediated transcription of PER1 which plays an important role in the photic entrainment of the circadian clock. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UUV9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23373
Name Human Torc1 (aa 264-322) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI413414; CH211-255D18.10; CH211-255D18.9; CREB regulated transcription coactivator 1; CREB regulated transcription coactivator 1 b; CREB-regulated transcription coactivator 1; CREB-regulated transcription coactivator 1; CREB-regulated transcription coactivator 1 b; CRTC1; crtc1b; FLJ14027; KIAA0616; MECT 1; Mect1; mKIAA0616; mucoepidermoid carcinoma translocated 1; mucoepidermoid carcinoma translocated protein 1; Mucoepidermoid carcinoma translocated protein 1 homolog; R74955; si:ch211-255d18.8; TORC1; TORC-1; transducer of CREB protein 1; transducer of regulated cAMP response element-binding protein (CREB) 1; transducer of regulated cAMP response element-binding protein 1; WAMTP1; zfTorc1
Common Name Torc1
Gene Symbol CRTC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.