Invitrogen™ Human Torc1 (aa 139-218) Control Fragment Recombinant Protein

Product Code. 30211999

Brand: Invitrogen™ RP93576

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82786 (PA5-82786. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. In the hippocampus, involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. May be required for dendritic growth of developing cortical neurons. In concert with SIK1, regulates the light-induced entrainment of the circadian clock. In response to light stimulus, coactivates the CREB-mediated transcription of PER1 which plays an important role in the photic entrainment of the circadian clock. [UniProt]

Specifications

• Accession Number: Q6UUV9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23373
• Name: Human Torc1 (aa 139-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI413414; CH211-255D18.10; CH211-255D18.9; CREB regulated transcription coactivator 1; CREB regulated transcription coactivator 1 b; CREB-regulated transcription coactivator 1; CREB-regulated transcription coactivator 1; CREB-regulated transcription coactivator 1 b; CRTC1; crtc1b; FLJ14027; KIAA0616; MECT 1; Mect1; mKIAA0616; mucoepidermoid carcinoma translocated 1; mucoepidermoid carcinoma translocated protein 1; Mucoepidermoid carcinoma translocated protein 1 homolog; R74955; si:ch211-255d18.8; TORC1; TORC-1; transducer of CREB protein 1; transducer of regulated cAMP response element-binding protein (CREB) 1; transducer of regulated cAMP response element-binding protein 1; WAMTP1; zfTorc1
• Common Name: Torc1
• Gene Symbol: CRTC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining