Invitrogen™ Human TOR3A (aa 274-350) Control Fragment Recombinant Protein

Artikelnummer. 30200997

missing translation for 'mfr': Invitrogen™ RP94515

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55972 (PA5-55972. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains unknown.

Spezifikation

• Accession Number: Q9H497
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64222
• Name: Human TOR3A (aa 274-350) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Adir; ADIR2; ATP-dependant interferon response protein 1; ATP-dependant interferon responsive; ATP-dependent interferon-responsive protein; si:ch211-198n5.8; Tor3a; Torsin family 3 member A; torsin family 3, member A; torsin-3 A
• Common Name: TOR3A
• Gene Symbol: TOR3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining