Invitrogen™ Human TOPAZ1 (aa 271-365) Control Fragment Recombinant Protein

Product Code. 30197838

Brand: Invitrogen™ RP100230

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62297 (PA5-62297. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The testis and ovary specific PAZ domain containing 1 (TOPAZ1) protein is a highly conserved protein that is highly expressed in the gonads during germ cell meiosis, suggesting that it may play a role in germ cell development. It contains a PAZ domain and a zinc finger domain and is exclusively expressed in adult testis and fetal ovary.

Specifications

• Accession Number: Q8N9V7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 375337
• Name: Human TOPAZ1 (aa 271-365) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C3orf77; Gm9524; Protein TOPAZ1; RGD1563398; testis and ovary specific PAZ domain containing 1; testis and ovary-specific PAZ domain gene 1; testis- and ovary-specific PAZ domain-containing protein 1; topaz 1; Topaz1
• Common Name: TOPAZ1
• Gene Symbol: TOPAZ1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining