Invitrogen™ Human TOMM34 (aa 117-188) Control Fragment Recombinant Protein

Product Code. 30209146

Brand: Invitrogen™ RP103277

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63361 (PA5-63361. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats.

Specifications

• Accession Number: Q15785
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10953
• Name: Human TOMM34 (aa 117-188) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610100K07Rik; hTom34; HTOM34P; mitochondrial import receptor subunit TOM34; outer mitochondrial membrane translocase (34 kD); TOM34; Tomm34; Translocase of outer membrane 34 kDa subunit; translocase of outer mitochondrial membrane 34; URCC3
• Common Name: TOMM34
• Gene Symbol: Tomm34
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining