Invitrogen™ Human TOMM20 (aa 27-144) Control Fragment Recombinant Protein

Product Code. 30209471

Brand: Invitrogen™ RP90451

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52843 (PA5-52843. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mitochondrial preprotein translocases of the outer membrane (Tom) is a multisubunit protein complex that facilitates the import of nucleus-encoded precursor proteins across the mitochondrial outer membrane. The Tom machinery consists of import receptors for the initial binding of cytosolically synthesized preproteins and a general import pore (GIP) for the membrane translocation of various preproteins into the mitochondria. The import receptors include Tom20 and Tom22, which form a heteromeric receptor complex that initiates the insertion of newly synthesized proteins into the outer membrane and then directs the precursor protein into the GIP. In yeast, Tom22 is the essential component of the import receptor complex as it functions as both a receptor for the preproteins and serves as a docking point for both Tom20 and the GIP.

Specifications

• Accession Number: Q15388
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9804
• Name: Human TOMM20 (aa 27-144) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810060K07Rik; BB284719; Gm19268; KIAA0016; MAS20; mitochondrial 20 kDa outer membrane protein; Mitochondrial import receptor subunit TOM20 homolog; mKIAA0016; MOM19; outer mitochondrial membrane receptor rTOM20; outer mitochondrial membrane receptor Tom20; TOM20; TOMM20; translocase of outer mitochondrial membrane 20; translocase of outer mitochondrial membrane 20 homolog (yeast); translocase of outer mitochondrial membrane 20 homolog type II
• Common Name: TOMM20
• Gene Symbol: TOMM20
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining