missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TOM70 (aa 137-259) Control Fragment Recombinant Protein

Product Code. 30204487
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204487 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204487 Supplier Invitrogen™ Supplier No. RP103013

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83890 (PA5-83890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Functional mitochondria require up to 1000 proteins to function properly, with 99% synthesized as precursors in the cytoplasm and transported into the mitochondria with the aid of cytosolic chaperones and mitochondrial translocators (import components). Proteins to be imported are chaperoned to the mitochondria by the cytosolic heat shock protein (cHSP70) and are immediately pursued by Translocators of the Outer Membrane (TOMs), followed by transient interactions of the unfolded proteins with Translocators of the Inner Membrane (TIMs). TOMM70A is ubiquitously expressed in human tissues and localizes in the mitochondria. TOMM70A could play a significant role in the import of nuclear-encoded mitochondrial proteins with internal targeting sites such as ADP/ATP carriers and the uncoupling proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94826
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9868
Name Human TOM70 (aa 137-259) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610044B22Rik; D16Ium22; D16Ium22e; D16Wsu109e; FLJ90470; KIAA0719; Mitochondrial import receptor subunit TOM70; mitochondrial precursor proteins import receptor; mKIAA0719; Tom70; Tomm70; Tomm70a; Translocase of outer membrane 70 kDa subunit; translocase of outer mitochondrial membrane 70; translocase of outer mitochondrial membrane 70 homolog A; translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae); translocase of outer mitochondrial membrane 70 homolog A (yeast); translocase of outer mitochondrial membrane protein 70
Common Name TOM70
Gene Symbol TOMM70
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.