Invitrogen™ Human TOM70 (aa 137-259) Control Fragment Recombinant Protein

Product Code. 30204487

Brand: Invitrogen™ RP103013

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83890 (PA5-83890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Functional mitochondria require up to 1000 proteins to function properly, with 99% synthesized as precursors in the cytoplasm and transported into the mitochondria with the aid of cytosolic chaperones and mitochondrial translocators (import components). Proteins to be imported are chaperoned to the mitochondria by the cytosolic heat shock protein (cHSP70) and are immediately pursued by Translocators of the Outer Membrane (TOMs), followed by transient interactions of the unfolded proteins with Translocators of the Inner Membrane (TIMs). TOMM70A is ubiquitously expressed in human tissues and localizes in the mitochondria. TOMM70A could play a significant role in the import of nuclear-encoded mitochondrial proteins with internal targeting sites such as ADP/ATP carriers and the uncoupling proteins.

Specifications

• Accession Number: O94826
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9868
• Name: Human TOM70 (aa 137-259) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610044B22Rik; D16Ium22; D16Ium22e; D16Wsu109e; FLJ90470; KIAA0719; Mitochondrial import receptor subunit TOM70; mitochondrial precursor proteins import receptor; mKIAA0719; Tom70; Tomm70; Tomm70a; Translocase of outer membrane 70 kDa subunit; translocase of outer mitochondrial membrane 70; translocase of outer mitochondrial membrane 70 homolog A; translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae); translocase of outer mitochondrial membrane 70 homolog A (yeast); translocase of outer mitochondrial membrane protein 70
• Common Name: TOM70
• Gene Symbol: TOMM70
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining