Invitrogen™ Human TOM1L2 (aa 158-242) Control Fragment Recombinant Protein

Product Code. 30207162

Brand: Invitrogen™ RP93432

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54604 (PA5-54604. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to a small gene family whose members have an N-terminal VHS domain followed by a GAT domain; domains which typically participate in vesicular trafficking. The canonical protein encoded by this gene also has a C-terminal clathrin binding motif. This protein has been shown to interact with Tollip, clathrin and ubiquitin and is thought to play a role in endosomal sorting. This gene resides in the 3.7 Mb deletion of chromosome region 17p11.2 that is associated with Smith-Magenis syndrome. Alternative splicing results in multiple transcript variants encoding distinct proteins.

Specifications

• Accession Number: Q6ZVM7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 146691
• Name: Human TOM1L2 (aa 158-242) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900016I08Rik; A730055F12Rik; AU042072; FLJ32746; myb1-like protein 2; Srebf1; target of myb1 like 2 membrane trafficking protein; target of myb1-like 2; target of myb1-like 2 (chicken); Target of Myb-like protein 2; Tom1l2; TOM1-like protein 2; UNQ3124
• Common Name: TOM1L2
• Gene Symbol: TOM1L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining