Invitrogen™ Human TOM1L1 (aa 126-220) Control Fragment Recombinant Protein

Product Code. 30210131

Brand: Invitrogen™ RP93275

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TOM1L1 is an adapter protein involved in signaling pathways. Interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated. May promotes FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.

Specifications

• Accession Number: O75674
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10040
• Name: Human TOM1L1 (aa 126-220) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310045L10Rik; C80573; Jerry protein; OK/KNS-CL0.3; RGD1562626; Src activating and signaling molecule; src-activating and signaling molecule protein; SRCASM; target of myb1 (chicken)-like 1; target of myb1 like 1 membrane trafficking protein; target of myb1-like 1; target of myb1-like 1 (chicken); Target of Myb-like protein 1; TOM1L1; TOM1-like protein 1; Unknown (protein for MGC:142395)
• Common Name: TOM1L1
• Gene Symbol: TOM1L1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPEQIGKLHSELDMVKMNVRVMS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining