Invitrogen™ Human TOB2 (aa 123-297) Control Fragment Recombinant Protein

Product Code. 30198094

Brand: Invitrogen™ RP105739

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64968 (PA5-64968. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TOB2 is a 344 amino acid rich novel member of the Tob/BTG1 anti-proliferative family of proteins characterized by similarities in their N-terminal BTG/Tob homology domains. This anti-proliferative protein inhibits cell cycle progression from the G0/G1 to S phases and is involved in cell cycle regulation through interaction with Caf1, a component of the CCR4 transcription factor complex that associates with cyclin-dependent kinases. Recent reports suggest that TOB2 plays important roles in spermatogenesis, embryonic dorsoventral patterning, osteogenesis, T-cell activation, learning and memory and acts primarily as a transcriptional repressor in several signaling pathways. TOB2, a signaling protein, may participate in transcriptional regulation of several genes. It is a regulatory protein ubiquitously expressed in most of the tissues.

Specifications

• Accession Number: Q14106
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10766
• Name: Human TOB2 (aa 123-297) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900090N22Rik; 4930545K18Rik; APRO5; AV071822; hypothetical protein; KIAA1663; mKIAA1663; protein Tob2; Protein Tob4; Tob2; TOB4; TOBL; Transducer of erbB-2 2; transducer of ERBB2, 2; TROB2
• Common Name: TOB2
• Gene Symbol: Tob2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining