Invitrogen™ Human TNK1 (aa 382-505) Control Fragment Recombinant Protein

Product Code. 30204097

Brand: Invitrogen™ RP89813

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110771 (PA5-110771. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNK1 tyrosine kinase, non-receptor 1 belongs to the tyrosine protein kinase family and as such is an important regulator of intracellular signal transduction pathways mediating cellular proliferation, survival, and development. TNK1 is highly expressed in fetal tissues and at lower levels in a few adult tissues. TNK1 may function in signaling pathways utilized broadly during fetal development, and more selectively in adult tissues. TNK1 plays a negative regulatory role in the Ras-Raf1-MAPK pathway, and knockout mice have been shown to develop spontaneous tumors, suggesting a role as a tumor suppressor gene.

Specifications

• Accession Number: Q13470
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8711
• Name: Human TNK1 (aa 382-505) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD38 negative kinase 1; Kinase of embryonic stem cells; Kos1; MGC46193; non-receptor tyrosine kinase; non-receptor tyrosine-protein kinase TNK1; TNK1; Tnk1a; Tnk1b; tyrosine kinase non receptor 1; tyrosine kinase, non-receptor 1; tyrosine kinase, non-receptor, 1
• Common Name: TNK1
• Gene Symbol: TNK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining