Invitrogen™ Human TNIP3 (aa 149-241) Control Fragment Recombinant Protein

Product Code. 30203747

Brand: Invitrogen™ RP100182

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60226 (PA5-60226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear factor NF-kappa-B plays key roles in development and immunity. ABIN3 (A20-binding inhibitor of NF-kappa-B activation 3), also known as TNFAIP3-interacting protein 3 (TNIP3), is a novel negative feedback regulator of LPS-induced NF-kappa-B activation. ABIN3 is a 39 kDa protein that negatively regulates NF-kappa-B activation in response to TNF and LPS. ABIN3 is highly expressed in brain, thymus, lymph node, lung and fetal liver, with low expression in kidney, bone marrow. Through its interaction with A20, ABIN3 interferes with TRAF2-mediated transactivation signals and NF-kappa-B inhibition is mediated by the ABIN-homology domain 2. ABIN3 has been found to be induced by Listeria infection and can be slightly downregulated by dexamethasone. Enhanced expression of ABIN3 in monocytes is associated with sepsis. Thus, ABIN3 is an IL-10-induced gene product capable of attenuating NF-kappa-B in human macrophages yet is inoperative in mice and represents a basis for species-specific differences in IL-10 actions. At least four isoforms of ABIN3 are known to exist.

Specifications

• Accession Number: Q96KP6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79931
• Name: Human TNIP3 (aa 149-241) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9030611K07Rik; A20-binding inhibitor of NF-kappa-B activation 3; ABIN3; ABIN-3; ABIN-3 beta; LIND; Listeria induced; listeria-induced gene protein; TNFAIP3 interacting protein 3; TNFAIP3-interacting protein 3; TNFAIP3-interacting protein 3 beta; Tnip3; TNIP3 beta
• Common Name: TNIP3
• Gene Symbol: TNIP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLNR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining