Invitrogen™ Human TNIP2 (aa 221-298) Control Fragment Recombinant Protein

Product Code. 30205007

Brand: Invitrogen™ RP104131

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64096 (PA5-64096. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNFAIP3, also known as A20, is located in chromosome band 6q23, a region that is often deleted in B cell lymphomas. Recently, it was identified as a tumor suppressor gene in Hodgkin lymphoma and several subtypes of non-Hodgkin lymphomas. TNFAIP3 was initially identified as a zinc-finger protein that is rapidly and transiently induced by TNF-a, inhibiting NF-kappa-B-dependent gene expression, and protecting cells from TNF-a-cytotoxicity. Overexpression of TNFAIP3 also inhibits the TLR2- and TLR4-mediated interleukin-8 synthesis in airway epithelial cells, suggesting that TNFAIP3 also acts as a negative regulator of TLR-mediated inflammatory responses, thereby protecting the host against harmful over-responses to pathogens. At least two isoforms of TNFAIP3 are known to exist.

Specifications

• Accession Number: Q8NFZ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79155
• Name: Human TNIP2 (aa 221-298) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810020H16Rik; A20 binding inhibitor of NF-kappaB activation-2; A20-binding inhibitor of NF-kappa-B activation 2; A20-binding inhibitor of NF-kappaB activation-2; ABIN2; ABIN-2; AI428870; Fetal liver LKB1-interacting protein; FLIP1; KLIP; TNFAIP3 interacting protein 2; TNFAIP3-interacting protein 2; Tnip2
• Common Name: TNIP2
• Gene Symbol: Tnip2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining