missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TNIP1 (aa 1-75) Control Fragment Recombinant Protein

Product Code. 30195780
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195780

Brand: Invitrogen™ RP96891

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83395 (PA5-83395. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Grasp65 is a structural protein of the golgi apparatus. It has been implicated in the stacking of golgi cisternae. Grasp65 is shown to have the properties to bind surfaces together in a mitotically regulated matter.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15025
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10318
Name Human TNIP1 (aa 1-75) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A20-binding inhibitor of NF-kappa B activation; A20-binding inhibitor of NF-kappa-B activation 1; ABIN; ABIN1; ABIN-1; AU018810; HIV-1 Nef-interacting protein; KIAA0113; Naf1; Nef; Nef-associated factor 1; Nef-associated factor 1 SNP; nip40-1; TNFAIP3 interacting protein 1; TNFAIP3-interacting protein 1; Tnip1; VAN; Virion-associated nuclear shuttling protein
Common Name TNIP1
Gene Symbol TNIP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.