Invitrogen™ Human TNIP1 (aa 1-75) Control Fragment Recombinant Protein

Product Code. 30195780

Brand: Invitrogen™ RP96891

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83395 (PA5-83395. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Grasp65 is a structural protein of the golgi apparatus. It has been implicated in the stacking of golgi cisternae. Grasp65 is shown to have the properties to bind surfaces together in a mitotically regulated matter.

Specifications

• Accession Number: Q15025
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10318
• Name: Human TNIP1 (aa 1-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A20-binding inhibitor of NF-kappa B activation; A20-binding inhibitor of NF-kappa-B activation 1; ABIN; ABIN1; ABIN-1; AU018810; HIV-1 Nef-interacting protein; KIAA0113; Naf1; Nef; Nef-associated factor 1; Nef-associated factor 1 SNP; nip40-1; TNFAIP3 interacting protein 1; TNFAIP3-interacting protein 1; Tnip1; VAN; Virion-associated nuclear shuttling protein
• Common Name: TNIP1
• Gene Symbol: TNIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining