Invitrogen™ Human TNFRSF14 (aa 3-100) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30199251	100 μL	100µL

Product Code. 30199251 Supplier Invitrogen™ Supplier No. RP88848

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNFRSF14 is a member of the TNF-receptor superfamily. TNFRSF14 was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to TNFRSF14 has been shown to be part of the viral entry mechanism. The cytoplasmic region of TNFRSF14 was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. Activation of the signal transduction pathway involving TNFRSF14 in T cells stimulates T cell proliferation and cytokine production, leading to inflammation and enhanced CTL-mediated tumor immunity, suggesting that these proteins may be useful as potential targets for controlling cellular immune responses. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these TNFRSF14 variants have not been determined.

Specifications

• Accession Number: Q92956
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8764
• Name: Human TNFRSF14 (aa 3-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Atar; CD270; CD40-like protein; herpes virus entry mediator; herpes virus entry mediator A; Herpesvirus entry mediator A; HGNC:11912; HVEA; Hvem; LIGHTR; RP3-395M20.6; sCD2710; TNF receptor superfamily member 14; Tnfrs14; TNFRSF14; TR2; tumo; Tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); Tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; UNQ329/PRO509
• Common Name: TNFRSF14 (HVEM)
• Gene Symbol: TNFRSF14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining