Invitrogen™ Human TNFAIP8 (aa 149-198) Control Fragment Recombinant Protein

Product Code. 30203077

Brand: Invitrogen™ RP101818

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63397 (PA5-63397. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNFalpha-IP 8 (tumor necrosis factor, alpha-induced protein 8), also known as NFkappa B-inducible DED-containing protein (NDED), SCC-S2 or TNF-induced protein GG2-1, is a 198 amino acid cytoplasmic protein induced by NFkappa B and TNF. The induction of TNFalpha-IP 8 by TNF is dependent on the activation of NFkappa B. TNFalpha-IP 8 negatively mediates apoptosis and may also play a role in tumor progression. TNFalpha-IP 8 specifically inhibits caspase-8 activity, which results in the inhibition of BID cleavage and caspase-3 activation during TNF-mediated apoptosis. TNFalpha-IP 8 is expressed at high levels in thymus, bone marrow, lymph node, spleen, thyroid, placenta and various tumor tissues, as well as fetal lung, liver and kidney. TNFalpha-IP 8 is present as three isoforms produced by alternative splicing.

Specifications

• Accession Number: O95379
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25816
• Name: Human TNFAIP8 (aa 149-198) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA987150; E130304C20Rik; ENSMUSG00000073567; GG2-1; Gm10539; head and neck tumor and metastasis-related protein; MDC3.13; MDC-3.13; Nded; NF-kappa-B-inducible DED-containing protein; SCC S2; SCCS2; SCC-S2; Ssc-2; TNF alpha induced protein 8; TNF alpha-induced protein 8; Tnfaip8; TNFalpha IP8; TNFalpha-IP 8; TNFalphaIP8; TNF-induced protein; TNF-induced protein GG2-1; Tumor necrosis factor alpha-induced protein 8; tumor necrosis factor, alpha induced protein 8; tumor necrosis factor, alpha-induced protein 8
• Common Name: TNFAIP8
• Gene Symbol: Tnfaip8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining