missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205282

Invitrogen™ Human TMX2 (aa 249-296) Control Fragment Recombinant Protein

Product Code. 30205282
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205282

Brand: Invitrogen™ RP104197

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64133 (PA5-64133. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y320
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51075
Name Human TMX2 (aa 249-296) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310042M24Rik; AA589631; Cell proliferation-inducing gene 26 protein; CGI-31; growth-inhibiting gene 11; My009; PDIA12; PIG26; protein disulfide isomerase family A, member 12; PSEC0045; thioredoxin domain containing 14; thioredoxin domain-containing protein 14; thioredoxin related transmembrane protein 2; thioredoxin-related transmembrane protein 2; thioredoxin-related transmembrane protein-like protein; TM x 2; TXNDC14; Unknown (protein for MGC:134152); UNQ237/PRO270
Common Name TMX2
Gene Symbol TMX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.