Invitrogen™ Human TMPRSS7 (aa 511-580) Control Fragment Recombinant Protein

Product Code. 30206034

Brand: Invitrogen™ RP95867

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59232 (PA5-59232. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Serine protease which preferentially hydrolyzes peptides with Arg at the P1 position. [UniProt]

Specifications

• Accession Number: Q7RTY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 344805
• Name: Human TMPRSS7 (aa 511-580) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B230219I23Rik; Gm1748; matriptase-3; TMPRSS7; Transmembrane protease serine 7; transmembrane protease, serine 7; transmembrane serine protease 7; type II transmembrane serine protease 7
• Common Name: TMPRSS7
• Gene Symbol: TMPRSS7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining