Invitrogen™ Human TMPRSS15 (aa 360-449) Control Fragment Recombinant Protein

Product Code. 30205910

Brand: Invitrogen™ RP108260

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84912 (PA5-84912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which activates other proenzymes including chymotrypsinogen and procarboxypeptidases. The precursor protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. This protein is a member of the trypsin family of peptidases. Mutations in this gene cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: P98073
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5651
• Name: Human TMPRSS15 (aa 360-449) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: enterokinase; enterokinase catalytic subunit; enteropeptidase; Enteropeptidase catalytic light chain; Enteropeptidase non-catalytic heavy chain; Entk; protease, serine, 7 (enterokinase); PRSS7; Serine protease 7; Tmprss15; Transmembrane protease serine 15; transmembrane protease, serine 15
• Common Name: TMPRSS15
• Gene Symbol: TMPRSS15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining