Invitrogen™ Human TMP21 (aa 33-103) Control Fragment Recombinant Protein

Product Code. 30180531

Brand: Invitrogen™ RP99885

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84012 (PA5-84012. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMP21 is a ubiquitously expressed protein that is involved in vesicular targeting and protein transport. More recent experiments have shown that it is also a component in the presenilin complex and modulates the -gamma-secretase but not the epsilon-secretase cleavage activity of the amyloid precursor protein. The presenilin complex is composed of the proteins APH1, nicastrin, and PEN2 in addition to presenilin-1. Together, these proteins cleave the amyloid precursor protein at what is known as the -gamma- and epsilon-sites and can lead to the accumulation of the Abeta cleavage product that is associated with Alzheimer's disease. Co-immunoprecipitation experiments using antibodies against these proteins also yielded TMP21 indicating that TMP21 may play a role in the regulation of this complex. Suppression of TMP21 expression by siRNA in transfected cells caused increased -gamma-secretase activity but not epsilon-secretase activity, and increased Abeta production, demonstrating that TMP21 can modulate -gamma-secretase activity.

Specifications

• Accession Number: P49755
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10972
• Name: Human TMP21 (aa 33-103) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110014C03Rik; 21 kDa transmembrane trafficking protein; 21 kDa transmembrane-trafficking protein; hypothetical protein; integral membrane protein p23; integral membrane protein Tmp21-I (p23); p23; p24 family protein delta-1; P24(DELTA); p24d1; p24delta; p24delta1; S31I125; S31III125; testicular tissue protein Li 206; tmed10; tmed10.L; TMP21; Tmp-21-I; transmembrane emp24 domain-containing protein 10; transmembrane emp24-like trafficking protein 10; transmembrane emp24-like trafficking protein 10 (yeast); transmembrane p24 trafficking protein 10; transmembrane p24 trafficking protein 10 L homeolog; transmembrane protein; transmembrane protein tmp21; transmembrane trafficking protein; transmembrane trafficking protein 21; XELAEV_18000191mg; Xp24d2; Xp24delta2
• Common Name: TMP21
• Gene Symbol: TMED10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining