Invitrogen™ Human TMOD4 (aa 141-202) Control Fragment Recombinant Protein

Product Code. 30210784

Brand: Invitrogen™ RP94424

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55795 (PA5-55795. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMOD4 blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton.

Specifications

• Accession Number: Q9NZQ9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29765
• Name: Human TMOD4 (aa 141-202) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: actin-capping protein; MTMOD; skeletal muscle tropomodulin; skeletal tropomodulin; SK-TMOD; TMOD4; tropomodulin 4; tropomodulin 4 (muscle); tropomodulin-4
• Common Name: TMOD4
• Gene Symbol: TMOD4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining