Invitrogen™ Human TMIE (aa 84-127) Control Fragment Recombinant Protein

Product Code. 30194059

Brand: Invitrogen™ RP96584

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58330 (PA5-58330. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment.

Specifications

• Accession Number: Q8NEW7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 259236
• Name: Human TMIE (aa 84-127) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5131400L21Rik; DFNB6; Mm0.8701; spinner; sr; Tmie; transmembrane inner ear; transmembrane inner ear expressed protein; transmembrane inner ear protein
• Common Name: TMIE
• Gene Symbol: TMIE
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining