Invitrogen™ Human TMEM68 (aa 164-245) Control Fragment Recombinant Protein

Product Code. 30207970

Brand: Invitrogen™ RP91032

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53758 (PA5-53758. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM68 gene ontology annotations related to this gene include transferase activity, transferring acyl groups.

Specifications

• Accession Number: Q96MH6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 137695
• Name: Human TMEM68 (aa 164-245) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010300G19Rik; AA408325; AW123402; RGD1309006; Tmem68; Transmembrane protein 68; Transmembrane protein 68-like protein
• Common Name: TMEM68
• Gene Symbol: TMEM68
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGFSLLLDVFCALHGPREKCVEILRSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVTKNAVQALIDKHQRIP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining