Invitrogen™ Human TMEM55A (aa 100-186) Control Fragment Recombinant Protein

Product Code. 30203676

Brand: Invitrogen™ RP90996

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53198 (PA5-53198. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM55A (PIP4P2, Phosphatidylinositol 4,5 Bisphosphate 4 Phosphatase 2) is a Protein Coding gene. Among its related pathways aresuperpathway of inositol phosphate compounds. An important paralog of this gene isPIP4P1.

Specifications

• Accession Number: Q8N4L2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55529
• Name: Human TMEM55A (aa 100-186) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: PIP4P2; PtdIns-4,5-P(2) 4-phosphatase type II; ptdIns-4,5-P2 4-Ptase II; TMEM55A; Transmembrane protein 55 A; type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 2 PtdIns-4,5-P2 4-Ptase; type II phosphatidylinositol 4,5-bisphosphate 4-phosphatase; type II phosphatidylinositol-4,5-bisphosphate 4-phosphatase
• Common Name: TMEM55A
• Gene Symbol: PIP4P2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining