Invitrogen™ Human TMEM5 (aa 63-141) Control Fragment Recombinant Protein

Product Code. 30205724

Brand: Invitrogen™ RP105298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66657 (PA5-66657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity.

Specifications

• Accession Number: Q9Y2B1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10329
• Name: Human TMEM5 (aa 63-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330415D21Rik; HP10481; MDDGA10; Ribitol-5-phosphate xylosyltransferase 1; RXYLT1; TMEM5; Transmembrane protein 5; type II membrane protein; UDP-D-xylose:ribitol-5-phosphate beta1,4-xylosyltransferase
• Common Name: TMEM5
• Gene Symbol: RXYLT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEEWNPWEGDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining