Invitrogen™ Human TMEM48 (aa 134-165) Control Fragment Recombinant Protein

Product Code. 30211360

Brand: Invitrogen™ RP107711

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67069 (PA5-67069. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.

Specifications

• Accession Number: Q9BTX1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55706
• Name: Human TMEM48 (aa 134-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810475A17Rik; AI450313; FLJ10407; FLJ12556; FLJ34120; hNDC1; ndc1; NDC1 transmembrane nucleoporin; NET3; nuclear division cycle 1 homolog; nucleoporin NDC1; RP4-654H19.1; tmem48; Transmembrane protein 48; wu:fk93f04; zgc:55636
• Common Name: TMEM48
• Gene Symbol: NDC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining