Invitrogen™ Human TMEM27 (aa 8-124) Control Fragment Recombinant Protein

Product Code. 30200514

Brand: Invitrogen™ RP91896

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61766 (PA5-61766. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM27 (Transmembrane protein 27) is also named as collectrin and Belongs to the TMEM27 family. It is a stimulator of beta cell replication and a membrane protein cleaved and shed by pancreatic beta cells that has been proposed as a beta cell mass biomarker. Western blot analysis of mouse collecting duct cell lines detected Tmem27 at an apparent molecular mass of 32 kDa. TMEM27 is an N-glycosylated protein and forms dimers, with MW of 64-75 kDa.

Specifications

• Accession Number: Q9HBJ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57393
• Name: Human TMEM27 (aa 8-124) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610008J07Rik; Cltrn; Collectrin; kidney-specific membrane protein; NX17; NX-17; Tmem27; Transmembrane protein 27; UNQ679/PRO1312
• Common Name: TMEM27
• Gene Symbol: TMEM27
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining