Invitrogen™ Human TMEM184B (aa 343-407) Control Fragment Recombinant Protein

Product Code. 30193581

Brand: Invitrogen™ RP92365

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54973 (PA5-54973. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM184B, also known as C22orf5, is a 407 amino acid multi-pass membrane protein and represents a novel gene in the activation of the MAPK signaling pathway. The gene encoding TMEM184B maps to human chromosome 22; mutations in several of the genes in chromosome 22 are involved in the development of autism, schizophrenia, Phelan-McDermid syndrome and Neurofibromatosis type 2, suggesting that TMEM184B may play a role in these syndromes.

Specifications

• Accession Number: Q9Y519
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25829
• Name: Human TMEM184B (aa 343-407) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610507A11; 4732495E13Rik; C22orf5; CTA-447C4.2; FM08; HS5O6A; HSPC256; PSEC0108; Putative MAPK-activating protein FM08; RGD1306591; Tmem184b; Transmembrane protein 184 B
• Common Name: TMEM184B
• Gene Symbol: TMEM184B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining