missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194798

Invitrogen™ Human TMEM16B (aa 79-167) Control Fragment Recombinant Protein

Product Code. 30194798
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194798

Brand: Invitrogen™ RP108423

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84348 (PA5-84348. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium-activated chloride channels (CaCC) are present in many cell types and mediate physiological functions such as epithelial secretion, sensory signal transduction, and smooth muscle contraction. Subunits of these CaCC’s include the transmembrane proteins TMEM16A and TMEM16B. TMEM16B is predicted to have eight transmembrane domains with both the amino and carboxy termini in the cytoplasm and is expressed in several tissues including olfactory sensory neurons as well as photoreceptors in mammalian retina. Like TMEM16A, TMEM16B is thought to form at least part of CaCC’s but has different biophysical characteristics such as voltage dependence and unitary conductance.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQ90
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57101
Name Human TMEM16B (aa 79-167) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ANO2; anoctamin 2; anoctamin 2 isoform Adelta4; anoctamin 2 isoform Bdelta4; anoctamin 2, calcium activated chloride channel; anoctamin 2-like; anoctamin-2; BC033409; C12orf3; LOC100361584; Tmem16b; Transmembrane protein 16 B; transmembrane protein 16 B (eight membrane-spanning domains)
Common Name TMEM16B
Gene Symbol Ano2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.