Invitrogen™ Human TMEM161B (aa 394-446) Control Fragment Recombinant Protein

Product Code. 30207408

Brand: Invitrogen™ RP96917

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60751 (PA5-60751. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM161B is a protein coding gene.

Specifications

• Accession Number: Q8NDZ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 153396
• Name: Human TMEM161B (aa 394-446) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810446P07Rik; AI843389; FLB3342; id:ibd2207; PRO1313; RGD1309660; si:dkey-195m1.1; tmem161b; Transmembrane protein 161 B; UNQ679/PRO1313; wu:fc31d04; zgc:63626
• Common Name: TMEM161B
• Gene Symbol: TMEM161B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLGNHSWGIYPESISTLPVDNSLLSNSVYSELPSAEGKMKVTVTQITVALSSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining