Invitrogen™ Human TMEM151B (aa 131-171) Control Fragment Recombinant Protein

Product Code. 30201785

Brand: Invitrogen™ RP101688

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63077 (PA5-63077. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM151B is a protein coding gene. Gene Ontology (GO) annotations related to this gene include integral component of membrane.

Specifications

• Accession Number: Q8IW70
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 441151
• Name: Human TMEM151B (aa 131-171) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA444E17.5; C6orf137; Gm323; TMEM151B; TMEM193; transmembrane protein 151 B; Transmembrane protein 193
• Common Name: TMEM151B
• Gene Symbol: TMEM151B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining