Invitrogen™ Human TMEM132A (aa 642-742) Control Fragment Recombinant Protein

Product Code. 30195996

Brand: Invitrogen™ RP100905

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62524 (PA5-62524. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is highly similar to the rat Grp78-binding protein (GBP). Alternatively spliced transcript variants encoding different isoforms have been described.

Specifications

• Accession Number: Q24JP5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54972
• Name: Human TMEM132A (aa 642-742) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720481D13Rik; GBP; glucose-regulated protein, 78 kDa; GRP78 binding protein; GRP78-binding protein; heat shock 70 kDa protein 5 (glucose-regulated protein, 78 kDa) binding protein 1; heat shock 70 kDa protein 5 binding protein 1; heat shock protein 5 binding protein 1; HSPA5-binding protein 1; Hspa5bp1; KIAA1583; LOW QUALITY PROTEIN: transmembrane protein 132 A; Orai1; R74613; TMEM132A; Transmembrane protein 132 A
• Common Name: TMEM132A
• Gene Symbol: TMEM132A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining