missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TMEM123 (aa 36-93) Control Fragment Recombinant Protein

Product Code. 30197549
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197549

Brand: Invitrogen™ RP108478

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111556 (PA5-111556. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transmembrane protein 123, or Tmem123, is a single-pass type I membrane protein and belongs to the CD164 family. Tmem123 acts as a novel marker for DC maturation. DCs are also known as professional antigen-presenting cells. It is reported that the Tmem123 molecule may be closely associated with the cell surface expression of CD40. It was also reported previously that Tmem123 protein may also be responsible for oncotic cell death, which is characterized by cell swelling, organelle swelling, vacuolization, increased membrane permeability and cell adhesion.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N131
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114908
Name Human TMEM123 (aa 36-93) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310075C12Rik; KCT3; KCT-3; keratinocytes associated transmembrane protein 3; keratinocytes-associated transmembrane protein 3; Porimin; PORMIN; pro oncosis receptor inducing membrane injury; pro-oncosis receptor inducing membrane injury; PSEC0111; RGD1305625; serine/threonine-rich receptor; TMEM123; Transmembrane protein 123; UNQ641/PRO1271
Common Name TMEM123
Gene Symbol TMEM123
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.