Invitrogen™ Human TMEM118 (aa 111-168) Control Fragment Recombinant Protein

Product Code. 30198238

Brand: Invitrogen™ RP102010

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64157 (PA5-64157. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM118 is a multi-pass membrane protein, and contains 1 RING-type zinc finger. The function of TMEM118 remains unknown.

Specifications

• Accession Number: Q96EX2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84900
• Name: Human TMEM118 (aa 111-168) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW049082; B830028P19Rik; hypothetical protein LOC553554; RGD1560195; RING finger and transmembrane domain-containing protein 2; RING finger and transmembrane domain-containing protein 2; ring finger protein, transmembrane 2; ring finger protein, transmembrane 2; RNFT2; si:dkey-175n1.1; Tmem118; Transmembrane protein 118; zgc:109947
• Common Name: TMEM118
• Gene Symbol: RNFT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QPHHHFHHGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining