Invitrogen™ Human TMEM108 (aa 229-316) Control Fragment Recombinant Protein

Code produit. 30201166

Marque: Invitrogen™ RP103506

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64110 (PA5-64110. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM108's function has not been determined yet.

Spécification

• Accession Number: Q6UXF1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 66000
• Name: Human TMEM108 (aa 229-316) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI462967; B130017P16Rik; cancer/testis antigen 124; CT124; KIAA1690; R74726; retrolinkin; RGD1311530; RTLN; TMEM108; Transmembrane protein 108; UNQ1875/PRO4318
• Common Name: TMEM108
• Gene Symbol: TMEM108
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining