missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201451

Invitrogen™ Human TMED1 (aa 27-91) Control Fragment Recombinant Protein

Product Code. 30201451
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201451

Brand: Invitrogen™ RP90026

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53826 (PA5-53826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known. The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13445
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11018
Name Human TMED1 (aa 27-91) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias hypothetical protein LOC538144; IL1RL1-binding protein; Il1rl1l; IL1RL1LG; interleukin 1 receptor-like 1 ligand; interleukin-1 receptor-like 1 ligand; Ly84l; lymphocyte antigen 84 ligand; MGC1270; p24 family protein gamma-1; p24g1; p24gamma1; putative T1/ST2 receptor-binding protein; St2l; Tmed1; Tp24; transmembrane emp24 domain containing 1; transmembrane emp24 domain-containing protein 1; transmembrane emp24 protein transport domain containing 1; transmembrane p24 trafficking protein 1
Common Name TMED1
Gene Symbol TMED1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.