Invitrogen™ Human TMCO3 (aa 374-428) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30210274	100 μL	100µL

Product Code. 30210274 Supplier Invitrogen™ Supplier No. RP91082

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61660 (PA5-61660. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable Na(+)/H(+) antiporter.

Specifications

• Accession Number: Q6UWJ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55002
• Name: Human TMCO3 (aa 374-428) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B230339H12Rik; C13orf11; C87304; LOW QUALITY PROTEIN: transmembrane and coiled-coil domain-containing protein 3; putative LAG1-interacting protein; RGD1306586; testis tissue sperm-binding protein Li 36 A; tmco3; Transmembrane and coiled-coil domain-containing protein 3; transmembrane and coiled-coil domain-containing protein 3; LOW QUALITY PROTEIN: transmembrane and coiled-coil domain-containing protein 3; transmembrane and coiled-coil domains 3; UNQ2419/PRO4976
• Common Name: TMCO3
• Gene Symbol: TMCO3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGMLVTQDVQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining