Invitrogen™ Human TMC5 (aa 236-332) Control Fragment Recombinant Protein

Product Code. 30182334

Brand: Invitrogen™ RP98635

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59834 (PA5-59834. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May function as ion channels, transporters, or modulators of such. Ubiquitously expressed.

Specifications

• Accession Number: Q6UXY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79838
• Name: Human TMC5 (aa 236-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932443L08Rik; AU016085; Tmc5; transmembrane channel like 5; transmembrane channel-like 5; transmembrane channel-like gene family 5; transmembrane channel-like protein 5; UNQ8238/PRO33604
• Common Name: TMC5
• Gene Symbol: TMC5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMASMEMANSYGHSLPGAPGSGYVNPAYVGESGPVH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining