Invitrogen™ Human TMC2 (aa 794-863) Control Fragment Recombinant Protein

Product Code. 30180645

Brand: Invitrogen™ RP99443

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61222 (PA5-61222. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. Mutations in this gene may underlie hereditary disorders of balance and hearing.

Specifications

• Accession Number: Q8TDI7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 117532
• Name: Human TMC2 (aa 794-863) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933416G09Rik; Beethoven; Bth; C20orf145; CWEA1; CWEA2; dJ686C3.3; dn; TMC2; transmembrane channel like 2; transmembrane channel-like 2; transmembrane channel-like gene family 2; transmembrane channel-like protein 2; transmembrane cochlear-expressed gene 2; transmembrane cochlear-expressed protein 2; transmembrane, cochlear expressed 2; UNQ907/PRO1928
• Common Name: TMC2
• Gene Symbol: TMC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining