Invitrogen™ Human TMBIM1 (aa 25-97) Control Fragment Recombinant Protein

Product Code. 30205158

Brand: Invitrogen™ RP90767

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52909 (PA5-52909. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Negatively regulates aortic matrix metalloproteinase-9 (MMP9) production and may play a protective role in vascular remodeling.

Specifications

• Accession Number: Q969X1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64114
• Name: Human TMBIM1 (aa 25-97) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310061B02Rik; AA960455; AU024746; C78899; Lfg3; mKIAA4161; MST100; MSTP100; PP1201; Protein lifeguard 3; Protein RECS1; Protein RECS1 homolog; PSEC0158; RECS1; Responsive to centrifugal force and shear stress gene 1 protein; Tmbib1; Tmbim1; transmembrane BAX inhibitor motif containing 1; transmembrane BAX inhibitor motif-containing protein 1
• Common Name: TMBIM1
• Gene Symbol: TMBIM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining