missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TLX3 (aa 68-141) Control Fragment Recombinant Protein

Product Code. 30204296
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204296

Brand: Invitrogen™ RP108335

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83146 (PA5-83146. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Hox proteins play a role in patterns of embryonic development and cellular differentiation by regulating downstream target genes. TLX3, also known as homeobox11-like1 (HOX11L2), is a DNA-binding nuclear transcription factor that is expressed in a subset of the primary sensory nervous system. TLX3, along with the related TLX1, is a selector transcription factor that promotes an excitatory glutamatergic neuronal phenotype over an inhibitory GABAergic phenotype opposing LBX1 signals during dorsal spinal cord development. Chromosomal translocations of the TLX3 gene have been shown to result in some forms of T-cell acute lymphoblastic leukemia (T-ALL).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43711
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 30012
Name Human TLX3 (aa 68-141) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias homeo box 11-like 2; homeobox 11-like 2; homeobox protein Hox-11L2; Homeobox TLX-3; HOX11L2; Respiratory neuron homeobox protein; RGD1564190; RNX; T cell leukemia, homeobox 3; T-cell leukemia homeobox 3; T-cell leukemia homeobox protein 3; T-cell leukemia, homeobox 3; Tlx1l2; TLX3
Common Name TLX3
Gene Symbol TLX3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence APFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.