Invitrogen™ Human TLX3 (aa 68-141) Control Fragment Recombinant Protein

Artikelnummer. 30204296

Marke: Invitrogen™ RP108335

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83146 (PA5-83146. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Hox proteins play a role in patterns of embryonic development and cellular differentiation by regulating downstream target genes. TLX3, also known as homeobox11-like1 (HOX11L2), is a DNA-binding nuclear transcription factor that is expressed in a subset of the primary sensory nervous system. TLX3, along with the related TLX1, is a selector transcription factor that promotes an excitatory glutamatergic neuronal phenotype over an inhibitory GABAergic phenotype opposing LBX1 signals during dorsal spinal cord development. Chromosomal translocations of the TLX3 gene have been shown to result in some forms of T-cell acute lymphoblastic leukemia (T-ALL).

Spezifikation

• Accession Number: O43711
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 30012
• Name: Human TLX3 (aa 68-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: homeo box 11-like 2; homeobox 11-like 2; homeobox protein Hox-11L2; Homeobox TLX-3; HOX11L2; Respiratory neuron homeobox protein; RGD1564190; RNX; T cell leukemia, homeobox 3; T-cell leukemia homeobox 3; T-cell leukemia homeobox protein 3; T-cell leukemia, homeobox 3; Tlx1l2; TLX3
• Common Name: TLX3
• Gene Symbol: TLX3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: APFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining